DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk1b5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:301 Identity:79/301 - (26%)
Similarity:116/301 - (38%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDK 79
            :::|..|..|         ||........||..|...:.||.||.|.::..| .:.|||.|:...
Mouse     4 LILFLALSLG---------GIDAAPPVQSRIFGGFNCEKNSQPWQVAVYRFT-KYQCGGVLLNAN 58

  Fly    80 LVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREE------HMVDAGFKH-----KLYDP 133
            .|||||||.  |......||:.             ||.|:      .:|.....|     .|.:.
Mouse    59 WVLTAAHCH--NDKYQVWLGKN-------------NFFEDEPSAQHRLVSKAIPHPDFNMSLLNE 108

  Fly   134 NT------HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT----------ATGWG 182
            :|      ::||:.:|||.|.....|.::|               |||.|          |:|||
Mouse   109 HTPQPEDDYSNDLMLLRLKKPADITDVVKP---------------IDLPTEEPKLGSTCLASGWG 158

  Fly   183 KTQ--MESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD--SNLCNGDSGGPL---GAV 240
            ...  :...:|.||.::.:..|.:.|.|...:.:.....|||:.|  .:.|.|||||||   |  
Mouse   159 SITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDG-- 221

  Fly   241 ITHKNTQRFVQVGIASYTNRNCQKASV---FTDVLSHAEFI 278
            :.|         ||.|:....|.|.:|   :|.::....:|
Mouse   222 VLH---------GITSWGPSPCGKPNVPGIYTKLIKFNSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/270 (27%)
Tryp_SPc 45..278 CDD:238113 72/269 (27%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 73/270 (27%)
Tryp_SPc 25..256 CDD:238113 73/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.