DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Cfb

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_032224.2 Gene:Cfb / 14962 MGIID:105975 Length:763 Species:Mus musculus


Alignment Length:262 Identity:59/262 - (22%)
Similarity:97/262 - (37%) Gaps:89/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YNSSPWMVFLHSTTDM---FVCGGSLITDKLVLTAAHCFIAN--QHLV-ARLGEYERTRSEECTG 111
            |:..||...:..|..:   ..|.|:::::..||||||||:.:  :|.: ..:|...|        
Mouse   489 YHKQPWQAKISVTRPLKGHETCMGAVVSEYFVLTAAHCFMVDDQKHSIKVSVGGQRR-------- 545

  Fly   112 YYCNFREEHMVDAGFKHKLYDPNTHAN-------------DIAILRLSKSVVYRDNIRPICV--- 160
                       |...:..|:.|..:.|             |:|:::|...:.|...:||||:   
Mouse   546 -----------DLEIEEVLFHPKYNINGKKAEGIPEFYDYDVALVKLKNKLKYGQTLRPICLPCT 599

  Fly   161 --------------VWDHRWR----------------HYLDKIDLLTATGWGKTQMESDSDALQT 195
                          ...|:.:                ..|.:.::....|..|...|.|:...|.
Mouse   600 EGTTRALRLPQTATCKQHKEQLLPVKDVKALFVSEQGKSLTRKEVYIKNGDKKASCERDATKAQG 664

  Fly   196 LD-IRRQPPDVCAKFIGQTIAGNQFCAGN----WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIA 255
            .: ::.....|..:|:         |.|.    .|.|.|.|||||||   |.||.: ||:|||:.
Mouse   665 YEKVKDASEVVTPRFL---------CTGGVDPYADPNTCKGDSGGPL---IVHKRS-RFIQVGVI 716

  Fly   256 SY 257
            |:
Mouse   717 SW 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/262 (23%)
Tryp_SPc 45..278 CDD:238113 59/262 (23%)
CfbNP_032224.2 CCP <54..82 CDD:214478
CCP 102..157 CDD:153056
CCP 164..218 CDD:153056
vWA_complement_factors 268..465 CDD:238747
Tryp_SPc 488..754 CDD:238113 59/262 (23%)
Trypsin 490..751 CDD:278516 58/261 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.