DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Egfbp2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:298 Identity:75/298 - (25%)
Similarity:118/298 - (39%) Gaps:82/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDK 79
            :::|..|..|         ||........|::.|...|.||.||.|.::...: .:|||.|:...
Mouse     4 LILFLALSLG---------GIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKE-HICGGVLLDRN 58

  Fly    80 LVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN---------- 134
            .|||||||:: :|:.| .||:.:..:.|...       :..:|...|.|..::.:          
Mouse    59 WVLTAAHCYV-DQYEV-WLGKNKLFQEEPSA-------QHRLVSKSFPHPGFNMSLLMLQTIPPG 114

  Fly   135 -THANDIAILRLSKSVVYRDNIRPI------------CVVWDHRWRHYLDKIDLLTATGWGK--- 183
             ..:||:.:|||||.....|.::||            |:                 |:|||.   
Mouse   115 ADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCL-----------------ASGWGSITP 162

  Fly   184 TQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW--DSNLCNGDSGGPL---GAVITH 243
            |:.:...| ||.:.|...|.:.|||...|.:.....|||..  ..:.|..||||||   |     
Mouse   163 TRWQKPDD-LQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDG----- 221

  Fly   244 KNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFI 278
                  :..|..||....|.|   .:::|:::....:|
Mouse   222 ------ILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/267 (26%)
Tryp_SPc 45..278 CDD:238113 68/266 (26%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 69/267 (26%)
Tryp_SPc 25..256 CDD:238113 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.