DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP001199

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321960.2 Gene:AgaP_AGAP001199 / 1281970 VectorBaseID:AGAP001199 Length:268 Species:Anopheles gambiae


Alignment Length:269 Identity:74/269 - (27%)
Similarity:111/269 - (41%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFL-----HSTTDMF-VCGGSLITDKLVLTAAHCFIANQHLVARLGEYE 102
            :|:.|..|..:..|:.:.|     :...|.| .||||||.:|.||||.||.   ...::..|..|
Mosquito    26 KIVGGEEAIAHEFPYQISLQWNYNNDEQDPFHFCGGSLIAEKFVLTAGHCV---PSAISPDGFPE 87

  Fly   103 RTRSEECTGYYCNFREEHMVDAG---------FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            ....|.....|         |||         :.|:.|:.:...|||||.|:.|......||:.:
Mosquito    88 AVAGEHDFSQY---------DAGVQRRRIAEMYVHEDYEGSVGPNDIAIFRVDKPFHLNRNIQLV 143

  Fly   159 CVVWDHRWRHYLDKIDLL-----TATGWGKTQMESD--------SDALQTLDIRRQPPDVCAK-F 209
            .          |.:.:.:     |.:|||.|....:        ...|..:|:     :||.| :
Mosquito   144 T----------LPEPNAIPTGETTISGWGSTSFSFEPSYPNILMKTTLPIMDL-----EVCRKIY 193

  Fly   210 IGQTIAGNQFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFT 269
            ..:|:|.:..|||..:  |::|:|||||||..:     ....|||||.|:....|   :...||.
Mosquito   194 FTETVADSNICAGTMEGTSSVCSGDSGGPLVQI-----DDEIVQVGIVSWGGIPCGGYKNPGVFV 253

  Fly   270 DVLSHAEFI 278
            .|....::|
Mosquito   254 RVSYFIDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/267 (27%)
Tryp_SPc 45..278 CDD:238113 73/266 (27%)
AgaP_AGAP001199XP_321960.2 Tryp_SPc 26..262 CDD:214473 73/267 (27%)
Tryp_SPc 27..265 CDD:238113 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.