DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:249 Identity:73/249 - (29%)
Similarity:104/249 - (41%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC---FIANQHLVARLGEYER 103
            |.||:.|......|.|:.|.|....: .:||||:|:...|||||||   :..|..:..|.|...:
Mosquito    40 ADRIVGGSKTTIESVPYQVSLRYFNN-HICGGSIISHSWVLTAAHCLDWYPHNDEITVRTGSTSQ 103

  Fly   104 TR--SEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRW 166
            :.  |.....||      |:      |:.||||....|:|.:|:...:.......||.:.....|
Mosquito   104 SAGGSLHAVFYY------HL------HERYDPNEFQWDVATVRVRTPMGLGAGRAPIPLATSTEW 156

  Fly   167 RHYLDKIDLLTATGWG-KTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCN 230
                ...:.:..|||| .|.....:|.||.:.:...|.:.|.:.....|..:..|||....:.|.
Mosquito   157 ----TVGERILVTGWGYLTAAGKVNDTLQMILLDAVPQESCNRTWTGFITADMLCAGGPGVDACA 217

  Fly   231 GDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA--SVFTDVL--SHAEFILR 280
            ||||||.        .|..||.||.|:.:.:|...  .|||::.  |...||.|
Mosquito   218 GDSGGPA--------VQDGVQYGIVSWGSIDCGNGLPGVFTNIAHPSVRSFIRR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/243 (28%)
Tryp_SPc 45..278 CDD:238113 68/242 (28%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 69/243 (28%)
Tryp_SPc 43..264 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.