DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP001365

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321778.5 Gene:AgaP_AGAP001365 / 1281817 VectorBaseID:AGAP001365 Length:608 Species:Anopheles gambiae


Alignment Length:281 Identity:84/281 - (29%)
Similarity:125/281 - (44%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFI 89
            |:..|:|. |.|.:|    |||.|.|:.....||.|.:: ..:.:.||||:|..:.:|||||| :
Mosquito   349 CATVLEPV-GTRIRS----RIIGGVTSNQGEHPWHVAIY-LDEEYQCGGSIIGRRWILTAAHC-L 406

  Fly    90 ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGF--------KHKLYDPNTHANDIAILRLS 146
            ..|:.       ..|...:....|....:...:|..|        .|:.|:|..:..||.:|||.
Mosquito   407 TRQNT-------NETLDVDLFRVYTGIIDISTIDDHFYRTADEVIVHRDYNPVMYTTDIGLLRLK 464

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLLT-------ATGWGKTQMESDSDALQTLDIRRQPPD 204
            :::.|...|:|:|:        |...:|:.|       .||||..:....|:.|..|::......
Mosquito   465 RNITYNSFIKPVCL--------YNRTVDISTFYGREGKVTGWGFNRDGVISNVLNYLEVPVVSQK 521

  Fly   205 VCA----KFIGQTIAGNQFCAGNWDSN-LCNGDSGGPLGAVITHKNTQRFVQVGIASYT--NRN- 261
            :|:    :|.|....|..||||:.|.| :|||||||.|    ......|:...||.|.:  .|| 
Mosquito   522 MCSQRNVQFNGVLAVGESFCAGHADGNSVCNGDSGGGL----VFAEGPRYYVRGIVSISAQRRNL 582

  Fly   262 --C--QKASVFTDVLSHAEFI 278
              |  .:.||||||.....:|
Mosquito   583 LLCDPNQYSVFTDVSKFLNWI 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/260 (30%)
Tryp_SPc 45..278 CDD:238113 76/259 (29%)
AgaP_AGAP001365XP_321778.5 GD_N 42..144 CDD:292649
GD_N 190..297 CDD:292649
Tryp_SPc 363..603 CDD:214473 77/260 (30%)
Tryp_SPc 364..606 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.