DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP001366

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321777.4 Gene:AgaP_AGAP001366 / 1281814 VectorBaseID:AGAP001366 Length:563 Species:Anopheles gambiae


Alignment Length:260 Identity:66/260 - (25%)
Similarity:115/260 - (44%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPW--MVFLHSTTDM-FVCGGSLITDKLVLTAAHCFIANQ--------HLVARL 98
            :.:|..::....||  .::..:.|:: ::||.:||:.:..:|||||....:        .|:...
Mosquito   315 VTHGTVSERGQFPWHGALYRSTVTELKYLCGATLISRRASITAAHCVTLEKSSKPVDAGSLLLYF 379

  Fly    99 GEYERTR---SEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160
            |:.:.::   .||    ....|..| :.|.::|:.:     .||||:|.|.:.:.|.:.:||:| 
Mosquito   380 GKIDLSKWNGPEE----DAQIRSIH-IPAQYQHERF-----FNDIAVLVLKEDIKYSNFVRPVC- 433

  Fly   161 VW--DHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVC----AKFIGQTIAGNQF 219
            :|  |..::..::||..:  .|||..:....|..|....:.....:.|    ..|..:..:...|
Mosquito   434 LWNFDDDYKTLINKIGFV--PGWGYNEHGLVSSRLSFAQMPVVAHETCIWSNRDFFSKVTSDTSF 496

  Fly   220 CAG-NWDSNLCNGDSGGPLGAVITHKN---TQRFVQVGIASYTNRNCQKAS--VFTDVLSHAEFI 278
            ||| ...:::|||||||  |.|..|.|   .:..|.|..|.....:|....  ||||......:|
Mosquito   497 CAGFKNGTSVCNGDSGG--GMVFKHNNLWYLRGIVSVSAALQDRFHCDSKHYVVFTDAAKFTSWI 559

  Fly   279  278
            Mosquito   560  559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/258 (25%)
Tryp_SPc 45..278 CDD:238113 65/258 (25%)
AgaP_AGAP001366XP_321777.4 GD_N 15..124 CDD:292649
Tryp_SPc 315..560 CDD:238113 66/260 (25%)
Tryp_SPc 315..559 CDD:214473 65/258 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.