DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPD3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321698.4 Gene:CLIPD3 / 1281744 VectorBaseID:AGAP001433 Length:670 Species:Anopheles gambiae


Alignment Length:284 Identity:90/284 - (31%)
Similarity:125/284 - (44%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDP-ACGIRTQSRTAYRIINGHTAKYNSSPWM--VFLHST--TDMFVCGGSLITDKLVLTAAHC- 87
            :|| .||  .|..::.||:.|..|.....|||  :|||.|  |: |.||||||..|.:|||||| 
Mosquito   410 VDPDDCG--QQEYSSGRIVGGIEAPTGQWPWMAAIFLHGTKRTE-FWCGGSLIGTKYILTAAHCT 471

  Fly    88 -------FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA-------- 137
                   |.|.|..| |||:.:.:...|             ..|...:|:.:...|.        
Mosquito   472 RDSRQRPFAARQFTV-RLGDIDLSTDGE-------------PSAPVTYKVTEVRAHPRFSRVGFY 522

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLL-----TATGWGKTQ---MESDSDALQ 194
            ||||:|.|.|.|.....:.|:|:...:     |...:.|     |..|||.|.   .||......
Mosquito   523 NDIALLVLDKPVRKSKYVIPVCLPGPN-----LPSKERLAGRRATVVGWGTTYYGGKESTKQQQA 582

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            ||.:.|.  :.|.:...|.|..|..|||..:..:  |.|||||||..::    ..|:.|||:.|:
Mosquito   583 TLPVWRN--EDCNRAYFQPITDNFVCAGFSEGGVDACQGDSGGPLMMLV----EARWTQVGVVSF 641

  Fly   258 TNRNCQK---ASVFTDVLSHAEFI 278
            .|: |.:   ..|:|.:..:.|:|
Mosquito   642 GNK-CGEPGYPGVYTRISEYMEWI 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 84/266 (32%)
Tryp_SPc 45..278 CDD:238113 83/265 (31%)
CLIPD3XP_321698.4 CLIP 292..335 CDD:197829
Tryp_SPc 424..664 CDD:214473 84/266 (32%)
Tryp_SPc 425..667 CDD:238113 84/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.