DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP001707

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_321381.5 Gene:AgaP_AGAP001707 / 1281466 VectorBaseID:AGAP001707 Length:511 Species:Anopheles gambiae


Alignment Length:299 Identity:78/299 - (26%)
Similarity:121/299 - (40%) Gaps:74/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST----TDMFVCGGSLITDKLVLTA 84
            ||.|   ||......|      |||..:.....||...:..|    ...::||.::|.::.::||
Mosquito   248 GCGQ---PAAVFNRLS------INGIRSPKGQFPWAAPIFDTGVPAKPKYICGSTIIGERHLVTA 303

  Fly    85 AHCF---IANQHLVARLGEYERTRSEECT--------GYYCNFREEHMVDAGFKHKLY---DPNT 135
            |||.   |.|          .|:.::..|        .::....:|..|...|.|:.|   |...
Mosquito   304 AHCMYDSIGN----------PRSANDLTTVPGMHNIDNFFDADLQERSVKKIFIHEDYYFEDSIL 358

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT-----ATGWGKTQMESDSDA--- 192
            ...|||::.:.:.:.|.:.:||||:     |:. .|.::.:.     .:|||.|:   |.:|   
Mosquito   359 LDTDIAVMLIDQPLTYNNLVRPICL-----WQE-SDNLEQIVGQKGFVSGWGVTE---DGNAKYP 414

  Fly   193 ---LQTLDIRRQPPDVCAKFIGQTIAGNQ--FCAGNWDSNLCNGDSGGPLGAVITHKNTQRF--- 249
               ..|:..||    .|.:.:.:.||||.  |||....|..|.||||.  |.||  |...|:   
Mosquito   415 SYVTATVVDRR----TCTRNLERLIAGNARIFCADGHGSVPCTGDSGS--GLVI--KRGSRYYIR 471

  Fly   250 --VQVGIASYTNRNC--QKASVFTDVLSHAEFILRVWRM 284
              |.||........|  .|..::||:.....::.||.:|
Mosquito   472 GIVSVGQYDPNTLTCARDKYVLYTDIAPFRYWLSRVVKM 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/271 (25%)
Tryp_SPc 45..278 CDD:238113 69/270 (26%)
AgaP_AGAP001707XP_321381.5 GD_N 50..150 CDD:292649
Tryp_SPc 261..507 CDD:238113 69/272 (25%)
Tryp_SPc 261..503 CDD:214473 69/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.