DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:244 Identity:68/244 - (27%)
Similarity:116/244 - (47%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHL----VARLGEYERTRSEECTGYYCNFREEHMVDAGF 126
            |..:.||||||.:..:||||||:.....:    |.|:|:.....:::     ..|.:|..:....
Mosquito    44 TVQWKCGGSLIWENYILTAAHCYADPDTILSPDVIRIGDLNLFDADD-----DEFVQERKIVQII 103

  Fly   127 KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI--DLLTATGWGKTQM-ES 188
            :|.|::.:|...|:|:|:|.|.|:..:.:.|.|:..|       |.|  ..|...|||:|.. :.
Mosquito   104 RHPLHNASTVYYDLALLKLDKKVIQSEGVIPTCLWLD-------DSIPFSTLEVAGWGQTGFGKE 161

  Fly   189 DSDALQTLDIRRQPPDVCAKF--------IGQTIAGNQFCAGNWDS--NLCNGDSGGPLGAVITH 243
            .|:.|...:::......|||:        :|..:|.:|.||  ||.  :.|.|||||||...:.:
Mosquito   162 KSNMLLKAELKLMTNTECAKYNNKRTQRRLGNDLADHQLCA--WDEVMDTCPGDSGGPLHYNLYY 224

  Fly   244 KNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEFILRVWRMYGKGQT 290
            |:|:....||:.|: .:.|  .:..|:..|....::|:...:..|:..|
Mosquito   225 KHTKIPFLVGVTSF-GKACAVSQPGVYVKVAKFKQWIIETLQEQGEQVT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/230 (28%)
Tryp_SPc 45..278 CDD:238113 65/230 (28%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 66/233 (28%)
Tryp_SPc 19..260 CDD:214473 65/230 (28%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.