DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPA5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:293 Identity:82/293 - (27%)
Similarity:135/293 - (46%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFLDPACGIRTQSRTAYRI--INGHTAKYNSSPWM--VFLHSTTD-------MFVCGGSLI 76
            ||.::.:.|.||:|.::...:.:  :....:.|...|||  |.|.|..|       ::.||||:|
Mosquito   106 SGRTEQVRPTCGVRNKNGLGFSVTGVKDGESHYGEFPWMVAVMLSSPMDNSDSILNVYQCGGSVI 170

  Fly    77 TDKLVLTAAHCFIANQ---HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN 138
            ...:||||||| :.|:   .|:.|.||:: |::|.....:.|.|...::    .|:.:|..:.||
Mosquito   171 APNVVLTAAHC-VFNKPKTQLLLRAGEWD-TQTEHELYMHQNRRVAEVI----LHEAFDNESLAN 229

  Fly   139 DIAILRLSKSVVYRDNIRPICV-----VWDHRWRHYLDKIDLLTATGWGKTQMESDSD---ALQT 195
            |:|:|.|::.....:|::|||:     .:|  ::|..       |:||||.|...:..   .|:.
Mosquito   230 DVALLTLAEPFQLGENVQPICLPPSGTSFD--YQHCF-------ASGWGKDQFGKEGKYQVILKK 285

  Fly   196 LDIRRQPPDVCAKFIGQTIAGNQF-------CAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQV 252
            :::...|...|.:.:.....||.|       |||. ...::|.||.|.||...|....| .:.|.
Mosquito   286 VELPVVPHAKCQETMRSQRVGNWFVLDQSFLCAGGVAGQDMCRGDGGSPLVCPIPGSPT-HYYQA 349

  Fly   253 GIASYTNRNCQK---ASVFTDVLSHAEFILRVW 282
            ||.:: ...|.:   ..|:.||.     .||.|
Mosquito   350 GIVAW-GLGCGEDGIPGVYGDVA-----FLRDW 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/266 (27%)
Tryp_SPc 45..278 CDD:238113 73/265 (28%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 76/264 (29%)
Tryp_SPc 135..377 CDD:214473 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.