DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPA2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:271 Identity:76/271 - (28%)
Similarity:127/271 - (46%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIIN-GHTAKYNSSPWMVFLHSTTDM-FVCGGSLITDKLVLTAAHCFIAN---- 91
            ||....:....|.|| ...|:|...||||.|....:. :.|.|:||..|.:||.||| :.|    
Mosquito   225 CGQLNLNGVVQRTINEDFRAEYGEFPWMVALFQLPEQRYCCNGALIDPKAILTTAHC-VTNCGGR 288

  Fly    92 -QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNI 155
             .:::.|.||:..:.:.|    ....||:..|.:..:|..|.|:...|:||:|.|:..|.|:..|
Mosquito   289 AANIMVRFGEWNMSSTHE----MAIPREDIGVKSVHQHPRYSPSALLNNIAVLELAHPVQYQATI 349

  Fly   156 RPICVVWDHRWRHYLDKIDLLTATGWGKTQMES--DSDALQTLDIRRQPPDVCAKFIGQT----- 213
            :|:|:...::   .|..::.:.|||||:...|:  .:..|:.||::|..|.:|.:.:.:.     
Mosquito   350 QPVCLPSANQ---PLRAMENMIATGWGRVMEENAPPTQILKRLDLQRMEPSICREALRRVRRPYP 411

  Fly   214 -IAGNQFCAGNWD----SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTD 270
             |..:.|.....:    ...|:||:|.|: .|.....|.|:...|:.|:.....||.   :|.|.
Mosquito   412 FILDSSFVCSTTNHGDQERPCDGDAGAPV-VVELPGTTNRYYLHGLVSWGYGCHQKQIPYTVLTK 475

  Fly   271 VLSHAEFILRV 281
            |:...|:|.|:
Mosquito   476 VVHFREWIDRI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/255 (28%)
Tryp_SPc 45..278 CDD:238113 71/254 (28%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 70/250 (28%)
Tryp_SPc 244..483 CDD:214473 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.