DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPA1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320725.2 Gene:CLIPA1 / 1280858 VectorBaseID:AGAP011791 Length:440 Species:Anopheles gambiae


Alignment Length:297 Identity:68/297 - (22%)
Similarity:118/297 - (39%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGH--TAKYNSSPWMVFLHSTTD-----MFVCGGSLITDKLVLTAAHCFIA 90
            ||.|......:.|.|..  .::|...||.|.:.:.|.     .::|||:||....|||.|.|.  
Mosquito   141 CGHRNPHGVIFTIENNQFSESEYGEYPWTVAIFARTKTESALKYLCGGALIDRAAVLTTASCL-- 203

  Fly    91 NQH--------LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSK 147
              |        ||.||||::.:...|...:.     :..::..:.|..|...:..|||||:.|..
Mosquito   204 --HPYRSDVSSLVVRLGEWDMSTVREPIPHI-----DSEMERIYLHPQYSMTSKVNDIAIVILGD 261

  Fly   148 SVVYRDNIRPICVVWDHRWRHYLDKIDL-------LTATGWGK-----TQMESDSDALQTLDIRR 200
            :|.....:..:|          |....:       :|..|||:     ...:.....|:...:..
Mosquito   262 TVELNHTVGVVC----------LPPAGMVPSTGTDVTGVGWGEVPNFVVPRKLPQTILKKAQLHH 316

  Fly   201 QPPDVCAKFIGQTIAGNQF-------CAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIAS 256
            ...::|.:.: :.:.|.:|       |....|:.:  |.||:|.|. .:.|...::|:..||::|
Mosquito   317 LSHELCQQTL-RKLMGRRFQLHSSFLCTTAQDAEMLPCRGDTGSPY-MMETVPGSERYYLVGLSS 379

  Fly   257 YTNRNCQK---ASVFTDVLSHAEFI--------LRVW 282
            : ..:|.|   .:|.|:|..|.::|        |.:|
Mosquito   380 W-GYDCNKQATPTVLTNVAYHRDWIDGVIKGEDLNIW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/272 (23%)
Tryp_SPc 45..278 CDD:238113 62/271 (23%)
CLIPA1XP_320725.2 Tryp_SPc 159..404 CDD:238113 60/266 (23%)
Tryp_SPc 159..403 CDD:214473 60/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.