DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:227 Identity:61/227 - (26%)
Similarity:102/227 - (44%) Gaps:31/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGH--TAKYNSSPWMV-------FLHSTTDMFVCGGSLITDKLVLTAAHCF 88
            ||:|..:...:||.:..  .::|...|||.       .|....:.::||||||...::||||||.
Mosquito   148 CGVRNSNGVQFRITDDSDGESEYGEFPWMAAILEEQKALDQIINTYMCGGSLIHPSVILTAAHCV 212

  Fly    89 --IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVY 151
              |....|..||||::....:|...:    ::..:|:..|..:.:.| ...|::|:|.|.|.|..
Mosquito   213 QNITITALKVRLGEWDTRSWKEPFPH----QDRRVVEIAFHEQFFAP-AALNNVALLFLDKPVEL 272

  Fly   152 RDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD---SDALQTLDIRRQPPDVCAKFIGQT 213
            .:.:..||:   ....:..|.:..: |:||||....::   ...|:.:::...|...|.:.:..|
Mosquito   273 METVNTICL---PPANYTFDPVRCV-ASGWGKDVFGNEGMFQAILKKVELPLMPRGACQRALRMT 333

  Fly   214 IAGNQF-------CAGNWDS-NLCNGDSGGPL 237
            ..|.:|       |||.... :.|.||.|.||
Mosquito   334 RLGRRFKLHESFLCAGGEKGRDTCKGDGGSPL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/216 (27%)
Tryp_SPc 45..278 CDD:238113 57/215 (27%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 56/208 (27%)
Tryp_SPc 167..407 CDD:214473 56/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.