DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:269 Identity:79/269 - (29%)
Similarity:124/269 - (46%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPA---CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHS--TTDMFVCGGSLITDKLVLTA 84
            |...:.|.   ||   .|||| :|:.|..|..|....||.|..  |.::| |.|::|:.:.||||
Mosquito   135 CRLVVQPQECDCG---WSRTA-KIVGGSVAGVNEYTAMVGLLDPLTVNVF-CSGAIISSRYVLTA 194

  Fly    85 AHC---FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLS 146
            |||   ..:...:.|.:|::: .||...|.|...:..|.::    .|:.|:..|..||||:|:.|
Mosquito   195 AHCARTIPSVSRVQALVGDHD-YRSGLDTPYSAIYNIEQII----SHEYYNEQTRNNDIALLKTS 254

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLD-KIDLLTATGWGKTQMESDSDAL---QTLDIRRQPPDVCA 207
            ..:.:...:.|||:.:.:....:.. .:|:   .|||.|........:   .||:: .|..:..|
Mosquito   255 TEMDFNRGVGPICLPFTYSTYSFGGLSVDI---AGWGTTSFGGPMSTILRKTTLNV-LQNANCTA 315

  Fly   208 KFIG-QTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA--SVFT 269
            .::. |.|.  .|..|. ||  |..||||.|..    :.:||...:||.||.:. |..:  ||.|
Mosquito   316 PYVNDQKIC--TFAVGR-DS--CQYDSGGALFL----RGSQRMYSIGIISYGSA-CAASTPSVAT 370

  Fly   270 DVLSHAEFI 278
            .|.::..:|
Mosquito   371 RVTAYLSWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/245 (29%)
Tryp_SPc 45..278 CDD:238113 70/244 (29%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 70/245 (29%)
Tryp_SPc 154..382 CDD:238113 71/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.