DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011910

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320619.4 Gene:AgaP_AGAP011910 / 1280754 VectorBaseID:AGAP011910 Length:408 Species:Anopheles gambiae


Alignment Length:287 Identity:74/287 - (25%)
Similarity:119/287 - (41%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLL--HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH 63
            |...|...||.:|.:....|.  ...|.      ||    .:...||:||.....|..|.|..|.
Mosquito   130 MTIRLTSAPTSMGGLFSCNLSIPQQSCE------CG----KKKLNRIVNGVETAVNEFPMMAALI 184

  Fly    64 ST-TDMFVCGGSLITDKLVLTAAHCFIAN--QHLVARLGEYERTRSEECTGYYCNFREEHMVDAG 125
            .. |...:||.:::|:...||||||.:..  ...|..:|::...     ||...:|.:.::|...
Mosquito   185 DVKTKTVICGATIVTNSYALTAAHCLLQRTVNDTVLLVGDHNIK-----TGTDTSFSQVYIVAQF 244

  Fly   126 FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD- 189
            ..|..:.....|||||::|..:.:.|...:.|.|:.|.:..:.:..:  .:.|||||....... 
Mosquito   245 MSHPGFTVRPVANDIALVRTGRPIQYNPGVGPACLPWSYTTQSFEGR--TVEATGWGDLDFGGPR 307

  Fly   190 SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            :.||..:.:.......|::.:..::...|.|....:.:.|.|||||||  ..|:........|||
Mosquito   308 ATALNKVQLAVIGNQECSQRLSASVPYQQLCTYTANRDTCQGDSGGPL--FFTNLANGLLYDVGI 370

  Fly   255 ASYTNRNCQKA--SVFTDVLSHAEFIL 279
            .|: ...|..|  ||.|.|..:.::|:
Mosquito   371 VSF-GIACATANPSVNTRVTEYLDWIM 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/239 (27%)
Tryp_SPc 45..278 CDD:238113 63/238 (26%)
AgaP_AGAP011910XP_320619.4 CUB 27..146 CDD:238001 5/15 (33%)
Tryp_SPc 165..395 CDD:214473 64/239 (27%)
Tryp_SPc 166..396 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.