DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011912

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320615.4 Gene:AgaP_AGAP011912 / 1280750 VectorBaseID:AGAP011912 Length:408 Species:Anopheles gambiae


Alignment Length:268 Identity:64/268 - (23%)
Similarity:107/268 - (39%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLV 95
            :||:|..|    :|:||.....|..|.|. .:.|::....||.::|:|...:|||||.       
Mosquito   161 SCGLRRTS----KIVNGVPTLVNEFPMMAGLVDSSSRSVFCGATIISDYHSITAAHCM------- 214

  Fly    96 ARLGEYERTRSEECTGYYCNFREEHMVDAG--------------FKHKLYDPNTHANDIAILRLS 146
                   |.||...:|....   :|.:..|              ..|..|..:...||||::|.:
Mosquito   215 -------RGRSLSASGLLVG---DHNLSVGTDTSYSVLMRLASITNHPQYVVSPSRNDIALVRTA 269

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES-DSDALQTLDIRRQPPDVCAKFI 210
            ..:.:...:.|.|:.:.:...::...|  :.|||||.....: .|:.|:.:.:.......|...:
Mosquito   270 DRIAFNAAVGPACLPFRYSTSNFAGSI--VEATGWGTMDFGAPTSNVLRKVSLNVISEQSCQSSM 332

  Fly   211 GQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLS 273
            ...:| :..|......:.|..||||||    ......|...||:.:| ..:|  .|.||.:.:.|
Mosquito   333 PNILA-SHICTYTPGKDTCQYDSGGPL----LFTTGGRVYLVGVVNY-GVSCASSKPSVSSRITS 391

  Fly   274 HAEFILRV 281
            :..:|..|
Mosquito   392 YLSWIQSV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/251 (23%)
Tryp_SPc 45..278 CDD:238113 58/250 (23%)
AgaP_AGAP011912XP_320615.4 CUB 55..155 CDD:238001
Tryp_SPc 169..396 CDD:214473 58/251 (23%)
Tryp_SPc 170..399 CDD:238113 59/253 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.