DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012020

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320509.4 Gene:AgaP_AGAP012020 / 1280648 VectorBaseID:AGAP012020 Length:753 Species:Anopheles gambiae


Alignment Length:273 Identity:73/273 - (26%)
Similarity:119/273 - (43%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLH----------STTDMFVCGGSLITDKLVLTAAHCFIANQHL---VA 96
            :.:|.||..:.     |.|          .|...::||||||.:..:||||||.....:.   ||
Mosquito    18 VFHGITANLDD-----FSHIAAIGWKNDDRTRTKWLCGGSLIRENFILTAAHCTADENNTPPDVA 77

  Fly    97 RLGE---YERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            |:|:   |....:|..       :|..:||. .:|..|...:...|||:::|.::|.....:.|.
Mosquito    78 RMGDLNIYSNADNEYA-------QELKIVDV-IRHPNYKFTSSYYDIALMKLERNVSVTRYVIPT 134

  Fly   159 CVVWDHRWRHYLDKIDLLTATGWGKTQM-ESDSDALQTLDIRRQPPDVCAKFIGQ-------TIA 215
            |:     |.....:...|.|.|||:|.. |:.|:.|..:.:.....|.|.|...:       .:.
Mosquito   135 CL-----WLEDEIRFPNLMAAGWGRTGFSENTSEILMKVQLSPVREDKCLKHYRKGDYKYRNGLL 194

  Fly   216 GNQFCAGNWDSNLCNGDSGGPLGA-VITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEF 277
            .:|.|||:.:.:.|.|||||||.. ::..|....|: ||:.|: .:.|  ....|:..|....::
Mosquito   195 DHQLCAGDEEMDTCPGDSGGPLHVMLLKDKKLVPFL-VGVTSF-GKICGVPAPGVYIKVSKFGDW 257

  Fly   278 ILRVWRMYGKGQT 290
            |:...:.||:..|
Mosquito   258 IIETLQRYGEMAT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/259 (27%)
Tryp_SPc 45..278 CDD:238113 69/259 (27%)
AgaP_AGAP012020XP_320509.4 Tryp_SPc 17..258 CDD:214473 69/259 (27%)
Tryp_SPc 18..261 CDD:238113 70/262 (27%)
Tryp_SPc 317..536 CDD:304450
Trypsin 323..533 CDD:278516
Tryp_SPc 641..>732 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.