DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012022

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320504.4 Gene:AgaP_AGAP012022 / 1280645 VectorBaseID:AGAP012022 Length:737 Species:Anopheles gambiae


Alignment Length:277 Identity:73/277 - (26%)
Similarity:123/277 - (44%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRT-AYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL 94
            ||.|.....|. |:....|.|.:..|..|:           ||||||.:..:||||||...:.::
Mosquito    20 PAAGSPAYLREFAHIAAIGWTNEDQSVRWL-----------CGGSLIWENFILTAAHCAADDNNV 73

  Fly    95 ---VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
               |||:|:......|:     ..|.::..:....:|..:..|::..|||:::|.::|...:.:.
Mosquito    74 PPDVARMGDINIYSDED-----DEFAQQLKIVEIIRHPKHKYNSNYYDIALMKLERNVTLHNTVA 133

  Fly   157 PICVVWDHRWRHYLDKIDL--LTATGWGKTQMESDSDALQTLDIRRQP--PDVCA-------KFI 210
            |.|:..|       |:|..  |.|.|||:|....|: ....|.::..|  .|.|:       :.:
Mosquito   134 PTCLWLD-------DEIRFPELLAAGWGRTGFGEDT-TKTLLKVQLAPITNDKCSTHYQRGVRKL 190

  Fly   211 GQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLS 273
            ...:..:|||||:...:.|.|||||||...:..|.......||:.|: .:.|  ....|:..|..
Mosquito   191 ENGLMDHQFCAGDEKMDTCPGDSGGPLHVKLFKKWKLVPFLVGVTSF-GKACGISAPGVYVKVSK 254

  Fly   274 HAEFILRVWRMYGKGQT 290
            .:::|:...:.:|:..|
Mosquito   255 FSDWIIETLQRHGEMAT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/249 (26%)
Tryp_SPc 45..278 CDD:238113 65/248 (26%)
AgaP_AGAP012022XP_320504.4 Tryp_SPc 23..262 CDD:238113 69/263 (26%)
Tryp_SPc 23..259 CDD:214473 68/260 (26%)
Tryp_SPc 335..533 CDD:304450
Tryp_SPc 648..>729 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.