DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB20

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320489.2 Gene:CLIPB20 / 1280631 VectorBaseID:AGAP012037 Length:370 Species:Anopheles gambiae


Alignment Length:270 Identity:63/270 - (23%)
Similarity:105/270 - (38%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQSRTAYRI-----------------INGHTAKYNSSPWMVFLHSTTDMFV---- 70
            |:......||.:|||...:                 :..|....:.|.....|.|:..:|:    
Mosquito    78 QYCCAEADIRRRSRTTVMVPMPEPDEDNSILDSDSCLQTHLGMDSGSIGRPSLDSSFGVFIAYKG 142

  Fly    71 ----CGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY 131
                |.|||||.:.|||||||....|.::..:... ..:.:..:|.|....|...|.....|:.|
Mosquito   143 RRSRCAGSLITPEYVLTAAHCVKKPQGMLLYVSAL-HVKHDTVSGGYQGDVEPMYVREAIIHEQY 206

  Fly   132 DPNTHANDIAILRLSKSVVYRDNI-RPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            :..|..:|||:|||:.|:....|. .|||:....:..........|:..|||.......:|:.|.
Mosquito   207 NTTTRDHDIALLRLNGSITQEGNSPSPICIPMGKKHDPVASVGYTLSCFGWGLNAYGKPNDSKQW 271

  Fly   196 LDIRRQPPDVCAKFIGQ---TIAGNQFCAGNWDSNLC----------NGDSGGPLGAVITHKNTQ 247
            :.:.|...::|...:..   .:||....:   :.|:|          :|.|||||    .::...
Mosquito   272 MTLERISLELCQARMDSLRVALAGRVIIS---ERNICTITITGNDAFSGFSGGPL----MYRKDG 329

  Fly   248 RFVQVGIASY 257
            .:..:|:.:|
Mosquito   330 TWYLIGLINY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/253 (23%)
Tryp_SPc 45..278 CDD:238113 57/252 (23%)
CLIPB20XP_320489.2 Tryp_SPc 136..362 CDD:214473 53/212 (25%)
Tryp_SPc 136..362 CDD:238113 53/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.