DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012328

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320219.3 Gene:AgaP_AGAP012328 / 1280372 VectorBaseID:AGAP012328 Length:324 Species:Anopheles gambiae


Alignment Length:284 Identity:86/284 - (30%)
Similarity:129/284 - (45%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCFI 89
            |..||::..:    ||:.|.....:..|||..|     ...|..|.|||:|:..|.||:|||||:
Mosquito    52 DEVCGVQMDN----RIVGGQRTSIDQYPWMALLQYINHRKGTKRFACGGALLNRKFVLSAAHCFV 112

  Fly    90 -----ANQHLVARLGEYERTRSE----------ECTGYYCNFREEHMVDAGFKHKLYDPNTHA-- 137
                 ...|.| ||||:: |.||          .|.....:...|.::    .|:.|..| ||  
Mosquito   113 RLPAGVELHKV-RLGEWD-TDSEIDCEDLDDELSCASPVQDLDYERII----IHEGYTGN-HADR 170

  Fly   138 -NDIAILRLSKSVVYRDNIRPICVV---WDHRWRHYLDKIDLLTATGWGKTQMESDSD-----AL 193
             ||||::.||.|..|.|.::|||:.   ..::.:.|...   :.|.|||:|:..|.|.     .|
Mosquito   171 ENDIALIELSGSAKYNDFVKPICLPEPGTPNKEKLYFGS---MWAAGWGRTETASGSRFKLYVPL 232

  Fly   194 QTLDIRRQPPDVCAKFIGQTIAGNQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            ...|: :...:...:.:...:...|||| |....:.|||||||||   :....|..:| ||:.|:
Mosquito   233 DLFDL-QSCNETYQRRVKVPLTETQFCAMGTPGKDTCNGDSGGPL---MKTMKTLHYV-VGVVSF 292

  Fly   258 TNRNCQKA--SVFTDVLSHAEFIL 279
            ..:.|...  :|:|.|....::|:
Mosquito   293 GPQRCGSGIPAVYTRVDKFYDWIV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 82/267 (31%)
Tryp_SPc 45..278 CDD:238113 81/266 (30%)
AgaP_AGAP012328XP_320219.3 CLIP 1..45 CDD:295450
Tryp_SPc 62..315 CDD:214473 82/267 (31%)
Tryp_SPc 63..315 CDD:238113 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.