DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009273

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320067.4 Gene:AgaP_AGAP009273 / 1280238 VectorBaseID:AGAP009273 Length:308 Species:Anopheles gambiae


Alignment Length:235 Identity:60/235 - (25%)
Similarity:95/235 - (40%) Gaps:52/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSLITDKLVLTAAHCFIANQHL---VARLGEYERTRSEECTGYYCNF-------REEHMVDAG 125
            |||||||.:.|||||||.....::   :.|||:.....::: ..|...|       ..||.    
Mosquito    97 CGGSLITLRFVLTAAHCAADANNIPPRLVRLGDVNLASTKD-DAYAQQFDILRIVRHPEHR---- 156

  Fly   126 FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI---DLLTATGWGKTQME 187
            |..|.:       |:|::.|...|...:.:.|.|:     |.:  .|:   ......|:|:..:.
Mosquito   157 FSRKYF-------DLALVELDGVVRLTEGVCPTCL-----WTN--SKVLPAQFFQTAGFGEITLG 207

  Fly   188 SDS------DALQTLDIRRQPPDVCAKFIGQT------IAGNQFCAGNWDSNLCNGDSGGPLGAV 240
            ..|      .||...|...     |::....|      |..:|.||...:::.|.|||||||...
Mosquito   208 GGSVPTLLKTALSATDSTE-----CSESFKYTRGLPEGIRHDQVCASMLNADTCQGDSGGPLQVS 267

  Fly   241 ITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEFI 278
            :...:|:....|.:.|: .|.|  ..:.|:..|.:|..:|
Mosquito   268 LRSYSTEHPFLVALTSF-GRGCGIGSSGVYQQVAAHIPWI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/233 (25%)
Tryp_SPc 45..278 CDD:238113 59/233 (25%)
AgaP_AGAP009273XP_320067.4 Tryp_SPc 56..308 CDD:238113 60/235 (26%)
Tryp_SPc 56..306 CDD:214473 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.