DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB16

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320055.4 Gene:CLIPB16 / 1280226 VectorBaseID:AGAP009263 Length:406 Species:Anopheles gambiae


Alignment Length:278 Identity:78/278 - (28%)
Similarity:124/278 - (44%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYN---SSPWMV---FLHSTTDMFV--CGGSLITDKLVLTAAHCF 88
            |||        ..|:.|..  ||   :.|::.   |.::.|..|:  |.||:|..::|||:|||.
Mosquito   142 ACG--------KSIVQGDF--YNGLGAYPFVARIGFKNTKTGTFIFPCSGSIIARQIVLTSAHCA 196

  Fly    89 I--ANQHLVA--RLGEYERTRSEEC--TGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSK 147
            :  |..|.::  |:|:|:.....:|  ||:.......|.|.....|..|....:.:|||:|.|..
Mosquito   197 LAKAESHRLSSVRVGDYDTRTDPDCGSTGFCAPVAINHAVSQIIVHPDYIEGQYHHDIALLILRT 261

  Fly   148 SVVYRDNIRPICVVWDHRWRHYLDKIDL-----LTATGWGK-TQMESDSDALQTLDIRRQPPDVC 206
            .:.|....:|||:        :..|.||     :...|||| :...:.|..||:|::.....|.|
Mosquito   262 PINYTVAAQPICL--------HARKQDLTVGRRVQIIGWGKLSTSAAKSPELQSLEVPLTSWDKC 318

  Fly   207 AKFIG--------QTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC- 262
            .:...        |:|.|...|||....:.|:|..|.||  :|  ::..|:.|:||.|:....| 
Mosquito   319 VRAYASTGALQSPQSIDGEWMCAGGEGRDACHGFGGAPL--II--RDQGRYAQIGIMSFGAETCG 379

  Fly   263 --QKASVFTDVLSHAEFI 278
              ...||:|.:..:|.:|
Mosquito   380 ALNMPSVYTSIAHYAPWI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/264 (28%)
Tryp_SPc 45..278 CDD:238113 74/263 (28%)
CLIPB16XP_320055.4 CLIP 88..126 CDD:295450
Tryp_SPc 157..400 CDD:238113 71/253 (28%)
Tryp_SPc 157..397 CDD:214473 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.