DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009252

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_320033.4 Gene:AgaP_AGAP009252 / 1280210 VectorBaseID:AGAP009252 Length:460 Species:Anopheles gambiae


Alignment Length:286 Identity:64/286 - (22%)
Similarity:105/286 - (36%) Gaps:87/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RTQSRTAYRI--INGHTAK------YNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHC 87
            |.....|:||  .:|.|.:      |.|.|::|.:     ......:.|.|:|||.|.|||:|.|
Mosquito   219 RELDECAHRIKASSGSTNEAQFETGYISEPYLVEVGWRGNGDAKAQWSCRGTLITSKAVLTSAKC 283

  Fly    88 FIANQHL---VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSV 149
             :..|.:   |.|||..|......             |:....|..:|..:..|:||::::..::
Mosquito   284 -LQQQSIAPSVIRLGLNEAAPVVN-------------VEETILHPEFDVASGKNNIALIKMKDAI 334

  Fly   150 VYRDN----IRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFI 210
               |.    |.|.|:                    | |.|..:..:.:|        |.:....:
Mosquito   335 ---DQSTIAINPACL--------------------W-KNQTHTPFEMIQ--------PVIKESTL 367

  Fly   211 GQTIAGNQF---CAGNW-----DSNLC----------NGDSGGPLGAVITHKNTQRFVQVGIASY 257
            |..:|..:|   |...:     :..||          .|||||.|...:.|........|.:.|:
Mosquito   368 GPALAFTKFNSDCDRTFRRTLDEHELCVDVEQLPYMDTGDSGGRLQVKLLHNAKVTPFVVAVTSF 432

  Fly   258 TNRNCQKAS--VFTDVLSHAEFILRV 281
            .:. |.:::  |:|.|..:|.:|..|
Mosquito   433 GSA-CGQSTPGVYTKVSKYAPWIRSV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 60/273 (22%)
Tryp_SPc 45..278 CDD:238113 59/272 (22%)
AgaP_AGAP009252XP_320033.4 Tryp_SPc 248..457 CDD:304450 55/255 (22%)
Tryp_SPc 248..454 CDD:214473 54/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.