DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009220

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_319997.4 Gene:AgaP_AGAP009220 / 1280178 VectorBaseID:AGAP009220 Length:325 Species:Anopheles gambiae


Alignment Length:260 Identity:85/260 - (32%)
Similarity:128/260 - (49%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||..|..:.::    |..||....|||..|.|....|.|||:||.::.|||||||.:.|.....|
Mosquito    72 CGAYTDDKISF----GQDAKLFQFPWMALLKSKAGSFFCGGTLINERYVLTAAHCLVNNDVASVR 132

  Fly    98 LGEYERTRSEECT--GYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160
            ||||:...:.:|.  |......::..|:....|:.|......:||.::||::.....||:.|||:
Mosquito   133 LGEYDLNSTIDCNKHGDCAPAPQDIPVERAISHEDYSARYKLHDIGLIRLARRASLNDNVLPICL 197

  Fly   161 VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAK-------FIGQTIAGNQ 218
            .....   :|.|..:....|||:||....::.||...:.....|.|.|       |:  .|:.:|
Mosquito   198 PVTPA---FLTKQTIFFVVGWGQTQNALFANKLQFTKLDLMANDECLKQLRPKDRFV--RISDSQ 257

  Fly   219 FCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFIL 279
            .|| |:..|:.|:|||||||.::....:  |:||.|:.|:..|.|.|.|   |:|.|..:.::||
Mosquito   258 LCAIGSNLSDNCSGDSGGPLKSISIQNS--RYVQYGVVSFGLRTCGKQSAPGVYTRVERYVDWIL 320

  Fly   280  279
            Mosquito   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/246 (33%)
Tryp_SPc 45..278 CDD:238113 80/245 (33%)
AgaP_AGAP009220XP_319997.4 Tryp_SPc 83..319 CDD:214473 80/242 (33%)
Tryp_SPc 83..319 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.