DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG43336

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:281 Identity:155/281 - (55%)
Similarity:198/281 - (70%) Gaps:7/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            |:..::|:..|:..:|       |.:||||.|||||..|.:..|:.||..|...|||||.|||||
  Fly     1 MNVVVVGLTFFLLPLL-------GSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHST 58

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ...|:|||||||::|||||||||:....||||||||:|...|.|...||.:|.|.||:.||:|:.
  Fly    59 DGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRH 123

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            |:|.|.|.|||||||.:.|.|.|||||||:|.|.|||.|:|.:|.||.||||||:.|.||..|:|
  Fly   124 YNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRT 188

  Fly   196 LDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
            :|:.|:.|:||.::...::..|||||||..|||||||||||:||:|.:..::|||||||||:||.
  Fly   189 VDLARKHPEVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNT 253

  Fly   261 NCQKASVFTDVLSHAEFILRV 281
            .|...||||||:|:.::||.|
  Fly   254 QCVMVSVFTDVMSYVDWILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 137/233 (59%)
Tryp_SPc 45..278 CDD:238113 136/232 (59%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 137/233 (59%)
Tryp_SPc 40..271 CDD:238113 136/230 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463261
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.790

Return to query results.
Submit another query.