DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG43110

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:282 Identity:93/282 - (32%)
Similarity:138/282 - (48%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIIL----MFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVC 71
            ||.|.|    ..||.:   |.||...||    .....:||:|..|...|:.:|..:.:||.: :|
  Fly     5 FVWIFLCSLGSCQLAY---SMFLKQPCG----KTPVPKIISGSNASQQSAQYMAGIFNTTHL-LC 61

  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTH 136
            ||::|.:..|||.||| .:.|.|..|||.|.....          .::..|.....|..|..:|:
  Fly    62 GGTIIHEDFVLTVAHC-KSTQTLFVRLGAYNINHP----------TDQIRVIETIAHPQYSNSTY 115

  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD-----KIDLLTATGWGKTQMESDSDALQTL 196
            |||||:::|.:||::..||:|||:        :||     :|....|.|||:|:....||.||.:
  Fly   116 ANDIALVKLERSVIFNLNIQPICI--------HLDATLGKQIRYYNAFGWGRTRNAEQSDILQRI 172

  Fly   197 DIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN 261
            .:.|..|.:|..::|.:....|.||.....:.|.|||||||.:.||::......|.||.||..|.
  Fly   173 FVNRTNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRE 237

  Fly   262 CQKASVFTDVLSHAEFILRVWR 283
            |....::|||..::.:|..:.|
  Fly   238 CNGVGLYTDVSQYSGWIANIVR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/238 (34%)
Tryp_SPc 45..278 CDD:238113 80/237 (34%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 80/238 (34%)
Tryp_SPc 36..257 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463385
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.