DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG43124

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:275 Identity:70/275 - (25%)
Similarity:115/275 - (41%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITD 78
            |:|||   :.|.:|.|:..| :....|     |||  :.|  :||:..:.|.:.: :|.|:||.:
  Fly    11 IVLMF---YQGSAQTLEEDC-VDHMER-----ING--SSY--APWLAEILSDSKV-ICAGALINN 61

  Fly    79 KLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAIL 143
            ..|||||.||..|:.|..|||          :||:....|...|...:....:.|..:.|::.|.
  Fly    62 LYVLTAASCFKENEKLTVRLG----------SGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIF 116

  Fly   144 RLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAK 208
            ||...|.::.:|||:|:                       |:.........|.:|..:.|.:.  
  Fly   117 RLQTEVEFKTHIRPMCI-----------------------TKSPKSLGLATTFEIINEKPKMW-- 156

  Fly   209 FIGQTIAGNQFC-------AGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS 266
            :..:.|.| .||       ...|.|.    .:|.|....|::...:..|:.||.||.: |.....
  Fly   157 YFCKNIKG-LFCKYVFGENEEKWQSK----PTGSPWTETISNGPFKGLVRYGILSYRD-NKTYDE 215

  Fly   267 VFTDVLSHAEFILRV 281
            |:.:|:||..:|.::
  Fly   216 VYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 60/240 (25%)
Tryp_SPc 45..278 CDD:238113 60/239 (25%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.