DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG43125

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:113/279 - (40%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLL--HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH-STTDMFVCGGSLI 76
            :.:|.||  :.|.:.||:..|              |.::.::.:||:|.:. ..:....|.|:||
  Fly     7 LAVFALLLFYQGSALFLEQNC--------------GKSSVFSPAPWLVKIRPELSSNITCTGTLI 57

  Fly    77 TDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIA 141
            .::.|||||.|......|:.||||.:.|........|    ||..|.....|:.|...:|..:||
  Fly    58 NERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQY----EEIYVARALIHRSYSSESHQYNIA 118

  Fly   142 ILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD------------ALQ 194
            :|||..||||:.||:|||:..:      :.|:.........|.:.|....            .|.
  Fly   119 LLRLKTSVVYKKNIQPICIDVN------VGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLS 177

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259
            ...:|...|||        |...|..|..|           ||...|  ..:..|.|.||.|:.|
  Fly   178 LFGVREPRPDV--------ILPPQPIAVGW-----------PLTKQI--NESALFHQYGILSHRN 221

  Fly   260 RNCQKASVFTDVLSHAEFI 278
            ...:| .|:|||:::..:|
  Fly   222 SESKK-DVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/246 (27%)
Tryp_SPc 45..278 CDD:238113 67/245 (27%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.