DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPC9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_318110.3 Gene:CLIPC9 / 1278509 VectorBaseID:AGAP004719 Length:362 Species:Anopheles gambiae


Alignment Length:320 Identity:80/320 - (25%)
Similarity:133/320 - (41%) Gaps:89/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM--VFLHS 64
            ||.:.....|..:|.        |..||| .|    ::...::|::|..|:....|.:  :.|.|
Mosquito    79 HTPVCQQNAFYRVIC--------CQPFLD-FC----ENSKQFQIMHGIEAEPGMFPHLARLGLKS 130

  Fly    65 TTD--MFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTG------------YYCN 115
            ..|  .:.|..::|:::.:||||||...|   :|.||..|   |.:|..            :..:
Mosquito   131 EEDGIAWTCSANIISERFLLTAAHCNPVN---IAGLGCAE---SMQCDQQNTVKKMWPIFFFLQS 189

  Fly   116 FREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL----- 175
            |.........||:         :|||::.|.:::.:...:.|||        .|:.|.||     
Mosquito   190 FISNPKYKTSFKY---------HDIALVELEQNIRFNKRVLPIC--------PYISKTDLHESED 237

  Fly   176 LTATGWG------------KTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCA-GNWDS 226
            |...|||            :|.:::| .|...:| ::..|    .|.:.|.|....:|| |....
Mosquito   238 LVIAGWGHFQSPRLMFATVRTVLQNDCKDHYASL-LKASP----NKKLHQGITDEMYCAQGALVD 297

  Fly   227 NL------CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS--VFTDVLSHAEFI 278
            |:      |:|||||||.   |.:|...:: :|:.| |...|..:|  ::|.|.|:..:|
Mosquito   298 NVTEYIDACSGDSGGPLQ---TKQNNNLYL-IGVIS-TGFGCGSSSPGLYTRVASYFGWI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/276 (25%)
Tryp_SPc 45..278 CDD:238113 70/275 (25%)
CLIPC9XP_318110.3 Tryp_SPc 109..355 CDD:238113 71/277 (26%)
Tryp_SPc 109..352 CDD:214473 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.