DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:254 Identity:66/254 - (25%)
Similarity:95/254 - (37%) Gaps:51/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCF----IANQHLVARLG 99
            |::.|......:.|:.|.|     ||      |||:::....:||||||.    :.......|.|
Mosquito    51 RVVGGSDTTIEAHPYQVSLRRLHKHS------CGGAILNTNTILTAAHCVDYPELVPSDFEVRAG 109

  Fly   100 EYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDH 164
            ...|...    |......:.|      .|..|:..|...||::|:|..|:.....::||.:  ..
Mosquito   110 STFRNEG----GQLITVAQIH------THPSYNDWTLEWDISVLKLVSSLQLSPTVQPISL--PD 162

  Fly   165 RWRHYLDKIDLLTATGWGKTQMESDS-DALQTLDIRRQPPDVCAKFIGQT------IAGNQFCAG 222
            |.....|...:..| |||....:..| :.||.:.:    |.|.....|..      |.....|||
Mosquito   163 RGLTIPDGTSVSLA-GWGSLYYQGPSTNHLQHVML----PIVSNSRCGMAYKNFAPILPFHICAG 222

  Fly   223 NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
            :...:.|.|||||||        ..:...|||.|: ...|   ...||:|.|....:||
Mosquito   223 HKGKDACQGDSGGPL--------VYQSRVVGIVSW-GYGCAFENYPSVYTRVSEFLDFI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/252 (25%)
Tryp_SPc 45..278 CDD:238113 63/251 (25%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 64/252 (25%)
Tryp_SPc 52..272 CDD:238113 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.