DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:213 Identity:60/213 - (28%)
Similarity:92/213 - (43%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ--HLVARL 98
            |:...:.:||:.|.....:.:|:.|.| ...:...||||::..|.|||||||....|  .|..||
Mosquito    33 RSPHGSGHRIVGGFEINVSDTPYQVSL-QYINSHRCGGSVLNSKWVLTAAHCTDGLQAFTLTVRL 96

  Fly    99 GEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWD 163
            |......|    |...|      |....:|..|:......|.|:|.|...:.:.|.::|:.:...
Mosquito    97 GSSRHASS----GTVVN------VARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQ 151

  Fly   164 HRWRHYLDKIDLLTAT---GWGKTQMESDSDA-LQTLDIRRQPPDVCAK-FIGQTIAGNQFCAG- 222
            .      :.:|..|.|   |||.|:..::|:| |:..::.....:.|.: :....|.....||| 
Mosquito   152 D------EAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRMLCAGY 210

  Fly   223 -NWDSNLCNGDSGGPLGA 239
             ....:.|.|||||||.|
Mosquito   211 QQGGKDACQGDSGGPLVA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/205 (29%)
Tryp_SPc 45..278 CDD:238113 58/204 (28%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 59/205 (29%)
Tryp_SPc 42..264 CDD:238113 58/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.