DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPE5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_314516.3 Gene:CLIPE5 / 1275278 VectorBaseID:AGAP010547 Length:373 Species:Anopheles gambiae


Alignment Length:219 Identity:41/219 - (18%)
Similarity:79/219 - (36%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FVCGGSLITDKLVLTAAHCFIANQH--LVARLGEYERTRSEECTGYYCNFREEHM--------VD 123
            |.|...||:...|:|:|.|.::.:.  .|.|||               |.|....        :.
Mosquito   175 FQCIAYLISTSAVVTSASCLVSKEFEPTVVRLG---------------NIRSGPQTTNIAIIPIS 224

  Fly   124 AGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES 188
            ....|..::.:|..|:||:|:|:..|.....:.|.| :|.::....::........|:       
Mosquito   225 TVEIHPEFNQSTFENNIALLKLTLPVQPTVYMFPGC-LWQNKTHSPVESAIFRGGNGF------- 281

  Fly   189 DSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLC-------NGDSGGPLGAVI---TH 243
              |.:..:.:|    |...:| .:|.:..:.        .|       .|:...|.|:.|   .:
Mosquito   282 --DPIHPMYVR----DCNVRF-ARTFSDPRI--------TCMVPGVYGTGEHCYPTGSPIIFRQN 331

  Fly   244 KNTQRFVQVGIASYTNRNCQKASV 267
            ::|..|.:..:..|::..|...|:
Mosquito   332 EDTNLFTEYLVNIYSHGRCNSTSL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 41/219 (19%)
Tryp_SPc 45..278 CDD:238113 41/219 (19%)
CLIPE5XP_314516.3 Tryp_SPc 174..>261 CDD:304450 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.