DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP004859

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_314332.2 Gene:AgaP_AGAP004859 / 1275102 VectorBaseID:AGAP004859 Length:264 Species:Anopheles gambiae


Alignment Length:243 Identity:60/243 - (24%)
Similarity:90/243 - (37%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 MVFLHST----TDMFVCGGSLITDKLVLTAAHCFIA-NQHLVARLGEYERTRSEECTGYYCNFR- 117
            :|.|.||    |..|.||||.|...:||..|||... ||..:      :..|....|....:|| 
Mosquito    33 IVLLGSTRSDGTREFRCGGSYIGQNIVLAGAHCVTGKNQPAL------DTVRFGSGTDNVMHFRI 91

  Fly   118 EEHMVDAGFKHKLYDPNTHANDIAILRLS--KSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATG 180
            ..|.:     |..|.|....:::|:..|.  ..:|.....:|.|::..|..:             
Mosquito    92 VNHTL-----HYRYKPQFEYHNMAVYYLDARPDLVNAGRFKPACILKPHMKQ------------- 138

  Fly   181 WGKTQMESDSD-----ALQTLDIRRQPPDVCAKF--------IGQTIAGNQFCAGNWDSNLCNGD 232
             |..||..||.     |||:..:.....:.|.::        .|..:.  .|||.|.|:..|:..
Mosquito   139 -GIVQMVGDSSNGRGLALQSTSLDVVASEKCHEYYNPIPKLRFGVLLC--CFCAMNSDTTECSNM 200

  Fly   233 SGGPLGAVITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEFI 278
            ...||..||..........:|..| ..:.|  :..:|||...|:.|::
Mosquito   201 HSSPLQLVINRNGKSVPFLIGHKS-IGKACGVKSPAVFTRYGSYYEWL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 60/241 (25%)
Tryp_SPc 45..278 CDD:238113 60/241 (25%)
AgaP_AGAP004859XP_314332.2 Trypsin 41..247 CDD:278516 56/233 (24%)
Tryp_SPc 43..250 CDD:304450 56/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.