DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:235 Identity:57/235 - (24%)
Similarity:93/235 - (39%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL----VARLGEYERTR 105
            ||.|...:...:|::..|........||||:|..:.:|||||| :.|.::    |.|:|..:   
Mosquito    35 IIGGTDVEDGKAPYLAGLVYNNSATYCGGSIIAARWILTAAHC-VTNVNVTNLTVVRVGTND--- 95

  Fly   106 SEECTGYYCNFR--EEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168
                     |:.  ..:.:|....|:.|...|..||:|:|||...:.:.:::             
Mosquito    96 ---------NYEGGSMYQIDRVIPHERYSAITFRNDVALLRLKTPIKFEEHV------------- 138

  Fly   169 YLDKIDL----------LTATGWGKTQMESDS-DALQTLDIRRQPPDVCAKFI-GQTIAGNQFC- 220
              :||:|          ||..|||......:: ...|.:.::....:.|.|.. |..|.....| 
Mosquito   139 --EKIELNEELVPINATLTIVGWGFVGWNKENPKRTQVIKVQHIGLNRCRKMANGSAIYPEHLCT 201

  Fly   221 ---AGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
               ||:   ..|.||||.|:        ..:..|||:.|:
Mosquito   202 FSRAGH---GPCKGDSGSPV--------VWKGKQVGVVSW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/235 (24%)
Tryp_SPc 45..278 CDD:238113 57/235 (24%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 57/235 (24%)
Tryp_SPc 35..254 CDD:214473 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.