DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPC3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_313589.2 Gene:CLIPC3 / 1274461 VectorBaseID:AGAP004318 Length:393 Species:Anopheles gambiae


Alignment Length:276 Identity:75/276 - (27%)
Similarity:126/276 - (45%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFL--------HSTTDMFVCGGSLITDKLVLTAAHCFIANQH----LVAR 97
            |:.|:..|....|.|..:        :|    |.||||||::..|||||||:..:..    .:.|
Mosquito   146 IVGGNVTKPGEFPHMAAIGWRQPNGGYS----FDCGGSLISEYYVLTAAHCYAESADGTLPSIVR 206

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYD-------PNTHA-----NDIAILRLSKSVV 150
            |||....|.                |.|.:.:.||       |:...     ||||:::|::.|:
Mosquito   207 LGEQSLVRE----------------DDGAEPENYDILRFIVHPDLKRSVGKYNDIALIQLTERVI 255

  Fly   151 YRDNIRPICVVWDHRWRHYLDKIDLLT--ATGWGKTQ-MESDSDALQTLDIRRQPPDVCA----- 207
            :.:.|||.|:       :..:.:::.|  |||:|:|: :.:.||.|:.:.:.....::||     
Mosquito   256 FTNFIRPACL-------YPSEVLNVRTAIATGFGRTEYLGAKSDELRKVALNIYNNELCAERYRY 313

  Fly   208 -KFIGQTIAGNQFCAGN--WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA--SV 267
             :.:.|.|...|.|.|:  ...:.|.||||||| .|...:|...|..:|:.| ..:.|..:  ::
Mosquito   314 DRHLRQGILSTQMCVGDLAGGKDTCQGDSGGPL-QVTVQENHCMFYILGVTS-LGQVCGSSTPAI 376

  Fly   268 FTDVLSHAEFILR-VW 282
            :|.|..:.::|.. ||
Mosquito   377 YTKVHPYLDWIESVVW 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/269 (27%)
Tryp_SPc 45..278 CDD:238113 72/269 (27%)
CLIPC3XP_313589.2 Tryp_SPc 146..390 CDD:238113 73/272 (27%)
Tryp_SPc 146..387 CDD:214473 72/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.