DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP003686

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_313469.4 Gene:AgaP_AGAP003686 / 1274361 VectorBaseID:AGAP003686 Length:368 Species:Anopheles gambiae


Alignment Length:272 Identity:81/272 - (29%)
Similarity:122/272 - (44%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWM---VFLHST--TDMFVCGGSLITDKLVLTAAHCFIANQ 92
            ||:   ..|..:|..|..|:....|||   |::.:|  |:...|.|::|..:.|||||||.....
Mosquito   119 CGL---PGTVNKIAFGQQARLFQYPWMAMIVYVSNTTGTESSECAGTIINVRYVLTAAHCIDGQM 180

  Fly    93 HLV--ARLGEYERTRSEECTGYYCNFREEHMVDA-----GFKHKLYDPN-----THANDIAILRL 145
            ..:  .|:|||:.....:|        ||....|     |.:..::.||     ...:||.:|||
Mosquito   181 ERMRYVRIGEYDTRTDPDC--------EEDTCAAPIQRYGVEDAIFHPNFTRIVRSGHDIGLLRL 237

  Fly   146 SKSVVYRD-NIRPICVVWDHRWRHYLDKID--LLTATGWGKTQ-MESDSDALQTLDIRRQPPDVC 206
            ::|:.:.. ::.|:|:.:...    |...|  |...||||.|: :|.....||.    |.||..|
Mosquito   238 NRSIDFSSGDVSPVCLPFTTG----LMGFDPTLYWITGWGLTERLEVSPVLLQA----RIPPVSC 294

  Fly   207 AKFIGQTIAGNQFCAGNWDSNL-CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTD 270
                  :::....|||..::.| |.||||||:.|.:...|. ||||.|:.|...| |....| ..
Mosquito   295 ------SLSSYAICAGFGNATLHCEGDSGGPMKAQVPEYNF-RFVQYGVISAGPR-CGTQGV-PG 350

  Fly   271 VLSHAEFILRVW 282
            :.|...|.:: |
Mosquito   351 ISSRVSFFMQ-W 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/255 (30%)
Tryp_SPc 45..278 CDD:238113 76/254 (30%)
AgaP_AGAP003686XP_313469.4 CLIP 16..75 CDD:288855
Tryp_SPc 131..362 CDD:214473 77/257 (30%)
Tryp_SPc 131..362 CDD:238113 77/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.