DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_312743.1 Gene:CLIPB8 / 1273740 VectorBaseID:AGAP003057 Length:405 Species:Anopheles gambiae


Alignment Length:289 Identity:80/289 - (27%)
Similarity:127/289 - (43%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFV----CGGSLITDKLVLTAAHCFIANQ 92
            :|||  ||..| :|..|..|:.:..|||..|....|...    |||:||:...|:|||||.....
Mosquito   127 SCGI--QSYVA-KIRGGQLAEIDEFPWMAMLLYERDNNALTQGCGGALISRTYVITAAHCVTGKN 188

  Fly    93 H-------LVARLGEYERTRSEECTGYYCNFRE--EHMVD----AGFKHKLYD--PNTHANDIAI 142
            .       ...||.||....:.:|. |..:.::  :.|:|    |...|..||  .:...:|||:
Mosquito   189 FQQTKGRLKFVRLREYNIHTNPDCV-YENDLKDCSDDMIDLVPQAVIPHPEYDSESSNQQHDIAL 252

  Fly   143 LRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS---DALQTLDIRRQPPD 204
            :|:.::..:.|.:|.||:. :..:.........|:.:|||:|.:..|:   |.|..:.::...|.
Mosquito   253 IRIEQTPPFTDFLRSICLP-EQNFESSATPGKKLSVSGWGRTDIFKDNLGPDVLSPIKLKLSLPY 316

  Fly   205 V----CAKFI---GQTIAGNQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQ--VGIASYTN 259
            |    |:|..   ...:...|.|||...: :.|.||||.||.:.    :.:|.:.  .||.|...
Mosquito   317 VEREKCSKTFRPWSFALGPGQMCAGGERAKDTCAGDSGSPLMSY----DMKRAIWYITGIVSLGV 377

  Fly   260 RNC---QKASVFTDVLSHAEFILRVWRMY 285
            |.|   ....|:|:|..:..:|    :||
Mosquito   378 RGCGVEGLPGVYTNVHHYLPWI----KMY 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/268 (26%)
Tryp_SPc 45..278 CDD:238113 71/267 (27%)
CLIPB8XP_312743.1 CLIP 41..95 CDD:288855
Tryp_SPc 136..399 CDD:214473 71/268 (26%)
Tryp_SPc 139..400 CDD:238113 71/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.