DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:228 Identity:68/228 - (29%)
Similarity:108/228 - (47%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AKYNSSPWMVFL------HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEEC 109
            ::|...||:|::      .:.:..|||||:||..:||:|.||.......||||.||::.:.::|.
Mosquito     3 SQYAEYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKTDLVARFGEWDISTTKEP 67

  Fly   110 TGYYCNFREEHM-VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI 173
            ....|.|..:.: |....||..|..|...||||:|.|:::|.|..:|||||:      ....|:.
Mosquito    68 FPQQCLFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICL------PQPTDEF 126

  Fly   174 --DLLTATGWGKTQMESDSDALQTLDIRRQPPDV----CAKFIG-------QTIAGNQFCAGNWD 225
              ....:.|||| :....::.::.|.:    |.:    |.:.:.       .|:.....|||...
Mosquito   127 VGQRCVSNGWGK-ERGVYANVMKKLTL----PVIGRANCTRMLRYAGLGPFYTLREGFLCAGGEV 186

  Fly   226 S-NLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            : ::|.||.|.|| |..|...|  :|..||.|:
Mosquito   187 AVDMCKGDGGSPL-ACQTESGT--YVLAGIVSW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/228 (30%)
Tryp_SPc 45..278 CDD:238113 68/228 (30%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 67/224 (30%)
Tryp_SPc 7..238 CDD:214473 67/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.