DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP010662

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_311382.4 Gene:AgaP_AGAP010662 / 1272470 VectorBaseID:AGAP010662 Length:584 Species:Anopheles gambiae


Alignment Length:306 Identity:86/306 - (28%)
Similarity:133/306 - (43%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHS------GCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH-----STTD 67
            |:|:..:.:|      ..:.:.|..||.|...|... :..|::.:....||...|:     |...
Mosquito     4 ILLLHNVRYSFAQDELHINDYNDNECGERMVKRKGL-VKGGYSTQPGDWPWHAALYHRGINSAGF 67

  Fly    68 MFVCGGSLITDKLVLTAAHCF--------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDA 124
            .:.||||::...||||||||.        |..:::..|||.:....:||      .:.||..|..
Mosquito    68 EYACGGSIVHRYLVLTAAHCVTLATSRRKIPAENMQLRLGRFNLMNNEE------EYAEEFDVIE 126

  Fly   125 GFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLL-------TATGWG 182
            ...|:.|.|.|..|||||||:...:::.|.|:|:|:     |:.. |.:.|.       |..|||
Mosquito   127 TIMHEGYRPTTFENDIAILRVEIPIIFNDYIQPVCL-----WKRD-DGVVLPWFYNQPGTVVGWG 185

  Fly   183 KTQMESDSDALQTLDIRRQP---PDVC----AKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGA 239
               :..|:....||:..|.|   ...|    ..|.|:.:....||||..: :.:|||||||  |.
Mosquito   186 ---LSEDNMIGTTLNEARMPVVDSWTCLASDRAFFGKFLQSKAFCAGYKNGTGVCNGDSGG--GM 245

  Fly   240 VITHKNTQRFVQVGIASYTNRN-----CQKASV--FTDVLSHAEFI 278
            ....:|  |:...|:.|::|.|     |.....  |||...:.:::
Mosquito   246 FFQFQN--RWYLKGVVSFSNTNDYSGVCNLKQYIGFTDASQYIDWV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/268 (29%)
Tryp_SPc 45..278 CDD:238113 78/267 (29%)
AgaP_AGAP010662XP_311382.4 Tryp_SPc 42..292 CDD:238113 78/267 (29%)
Tryp_SPc 42..289 CDD:214473 78/265 (29%)
Tryp_SPc 334..578 CDD:214473
Tryp_SPc 334..578 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.