DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:250 Identity:91/250 - (36%)
Similarity:129/250 - (51%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIAN-QHLVARLGEYERTRSE 107
            :|.||..|.....|||..|..|...|||||:||..:.||||||||... ..:..||||::.....
Mosquito   384 KIANGIDAILFQYPWMALLQDTELAFVCGGTLINKRYVLTAAHCFREKLSKISVRLGEFDLKSDI 448

  Fly   108 EC--TGYYCNFREEHM-VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHY 169
            :|  .|..|....:.: |:...|||.|......||||::||:....|.:|:.|||:......|..
Mosquito   449 DCDKRGERCALPPQDIAVERTIKHKDYSARHKVNDIALIRLASEASYNENVMPICLPVSPEMRTV 513

  Fly   170 LDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQ-----TIAGNQFCA--GNWDSN 227
            .   ::...:|||.|:.::.||.||...:|:.|.|||.:.:.:     |:..:|.||  .|...|
Mosquito   514 K---EIYYVSGWGLTENDTSSDVLQVGLLRQLPNDVCQQLLQRKDKYVTVNSDQMCAIGANRTDN 575

  Fly   228 LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFIL 279
             |:|||||||..|..:   .||||.|:.||..|.|.|.:   |:|.|.::.::||
Mosquito   576 -CSGDSGGPLKTVAVN---ARFVQYGVVSYGLRTCGKETAPGVYTRVENYIDWIL 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 89/247 (36%)
Tryp_SPc 45..278 CDD:238113 89/246 (36%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 89/247 (36%)
Tryp_SPc 385..625 CDD:238113 89/246 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.