DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP007142

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_308619.3 Gene:AgaP_AGAP007142 / 1269964 VectorBaseID:AGAP007142 Length:251 Species:Anopheles gambiae


Alignment Length:232 Identity:64/232 - (27%)
Similarity:98/232 - (42%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMF--VCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||:.|..|...::|:.|.|..   :|  :|||::|..:.|||||||.|....|:..|......||
Mosquito    27 RIVGGTEAAPGTAPYQVSLQG---LFSHMCGGTIIDRQWVLTAAHCAILPPKLMQVLAGTNDLRS 88

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLS---------KSVVYRDNIRPICVVW 162
            .         .:.:.|:..|.|..::.....||||:::|.         ::|.|.:...|:... 
Mosquito    89 G---------GKRYGVEQFFVHSRFNKPPFHNDIALVKLKTPLEFGEFVQAVEYSERQLPVNAT- 143

  Fly   163 DHRWRHYLDKIDLLTATGWGKTQME-SDSDALQTLDIRRQPPDVCAKFIGQTIA---GNQFCAGN 223
                         :.||||||.... |....|||:::|..|.:.|.:.:....|   |:......
Mosquito   144 -------------VRATGWGKVSTSGSVPRMLQTINLRYVPYEECKRLLEDNPAVDLGHICTLTK 195

  Fly   224 WDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIASY 257
            ....:|||||||||   |.|           ||:|::
Mosquito   196 EGEGVCNGDSGGPLVYEGKV-----------VGVANF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/232 (28%)
Tryp_SPc 45..278 CDD:238113 63/231 (27%)
AgaP_AGAP007142XP_308619.3 Tryp_SPc 27..243 CDD:214473 64/232 (28%)
Tryp_SPc 28..246 CDD:238113 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.