DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP007280

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_308537.4 Gene:AgaP_AGAP007280 / 1269883 VectorBaseID:AGAP007280 Length:2275 Species:Anopheles gambiae


Alignment Length:357 Identity:85/357 - (23%)
Similarity:123/357 - (34%) Gaps:128/357 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LHSGCSQFLDPA--CG-------------IRTQSRT-------AYRIINGHTAKYNSSPWMVFLH 63
            :|..|     ||  ||             :||:...       :.||:.|..|...:.|::|.:.
Mosquito   901 VHVKC-----PAVRCGTSRMHEQHAARINVRTRREANESEIVESVRIVGGSHADPEAYPFIVGIF 960

  Fly    64 STTDMFVCGGSLITDKLVLTAAHC---FIANQHLVARLGEYERTRS----EECTGYYCNFREEHM 121
             ....:.||||:..:..:::||||   |  :||.........|.||    .:.|      |..||
Mosquito   961 -RDGKYHCGGSIYNEHWIISAAHCCDNF--DQHYFEVRSGMLRKRSFAPQVQIT------RVTHM 1016

  Fly   122 VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI------DLLTATG 180
            :    .|..|..:..|||||::|:.....|...:||||:...||.....|.|      .:.||.|
Mosquito  1017 I----VHHAYSSSLMANDIALMRVEHPFHYNRWVRPICMPERHRTTDDRDWIWGPKAGTVCTAIG 1077

  Fly   181 WGK---------------------TQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW 224
            ||.                     .:.:||.|:|                        |.||...
Mosquito  1078 WGALRERGGAPDHLMQVSVPILGYCKHKSDRDSL------------------------QICAAEE 1118

  Fly   225 DS--NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLSHAEFILR---- 280
            |.  :.|.||||||. ...:..|...:...|:.|: ...|.:|   .|:|.|....::|..    
Mosquito  1119 DGGHDACQGDSGGPF-VCQSKSNPFEWYLAGVVSH-GEGCARAHEPGVYTRVALFIDWIAEKVNA 1181

  Fly   281 ----------------VWRMYGKGQTLPIPKK 296
                            :|   |.|..||..||
Mosquito  1182 PLPARTARADCPGMRCIW---GGGICLPPGKK 1210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/272 (25%)
Tryp_SPc 45..278 CDD:238113 68/271 (25%)
AgaP_AGAP007280XP_308537.4 LDLa 698..733 CDD:238060
Tryp_SPc 941..1175 CDD:214473 69/272 (25%)
Tryp_SPc 942..1178 CDD:238113 69/274 (25%)
LDLa 1196..1226 CDD:238060 7/18 (39%)
LDLa 1510..1541 CDD:238060
LDLa 1574..1609 CDD:238060
DUF1986 1774..1887 CDD:286432
LDLa 1999..2025 CDD:238060
LDLa 2038..2071 CDD:238060
LDLa 2107..2142 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.