DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:285 Identity:81/285 - (28%)
Similarity:125/285 - (43%) Gaps:57/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH----STTDM-FVCGGSLITDKLVLTAAHCF- 88
            |..||.|...|... :..|::......||...|:    ::.|. :.||.:::...||:|||||. 
Mosquito    34 DNECGERLVKRQEL-VKGGYSTHPGDWPWHAALYHRGFNSRDFEYACGSTIVHRYLVITAAHCVT 97

  Fly    89 -------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLS 146
                   |.:.::..|||.:....:||      .:.||..|.....|:.|.|.|..|||||||:.
Mosquito    98 FATSRRKIPSDNMQLRLGRFNLMNNEE------EYAEEFSVIDTIVHEGYRPTTLENDIAILRVE 156

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLL-------TATGWGKTQMESDSDALQTLDIRRQPPD 204
            ..:::.|.|:|:|:     |:.. |..||.       |..|||.    |:::.:.|.....|.|.
Mosquito   157 IPIIFNDYIQPVCL-----WKRD-DGFDLPNVYNQPGTVVGWGL----SENNRIGTTLNEAQMPV 211

  Fly   205 V----C----AKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
            |    |    ..|.|:.:....||||..: :.:|||||||  |.....:|  |:...||.|:::.
Mosquito   212 VNSWTCLASDRAFFGRFLQSKAFCAGYKNGTGVCNGDSGG--GMFFQFQN--RWYLKGIVSFSSV 272

  Fly   261 N-----CQKASV--FTDVLSHAEFI 278
            |     |.....  |||...:.:::
Mosquito   273 NDYSGWCNLRQYIGFTDASQYIDWV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/269 (28%)
Tryp_SPc 45..278 CDD:238113 76/268 (28%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113 76/268 (28%)
Tryp_SPc 50..297 CDD:214473 76/266 (29%)
Tryp_SPc 342..563 CDD:214473
Tryp_SPc 342..563 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.