DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_307756.2 Gene:CLIPB1 / 1269160 VectorBaseID:AGAP003251 Length:372 Species:Anopheles gambiae


Alignment Length:265 Identity:81/265 - (30%)
Similarity:125/265 - (47%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMV----FLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLV--ARLGE 100
            ||:.|..:..:..||:.    :..|....|.|||.||.::.|||||||.  :.:..:|  .||||
Mosquito   114 RIVGGGVSPIDGYPWLTRIQYYKGSNRYGFHCGGVLIHNQYVLTAAHCIEGVPSTWIVYQVRLGE 178

  Fly   101 YERTRSEECTGYYC-NFREEHMVDAGFKHKLYDPNTHA--NDIAILRLSKSVVYRDNIRPICVVW 162
            ::.|.:.:|....| :...:.:::|...|..|.....|  ||||:|:||::|.:.|.|||||:..
Mosquito   179 FDTTTTIDCVEDDCADPVRDVLINAYVVHPDYYKQNGADYNDIALLQLSETVEFTDFIRPICLPT 243

  Fly   163 DHRWRHYLDKIDL----LTATGWGKTQMESDSDALQTLDIRRQPPDVCA---KFIGQTIAGNQFC 220
            ....|    .::|    .|..|||:|:..:.|.....|.:.....:|||   ..|...|...|.|
Mosquito   244 SEESR----TVNLTGKYATVAGWGQTENSTSSTKKLHLRVPVVDNEVCADAFSSIRLEIIPTQLC 304

  Fly   221 AG---NWDSNLCNGDSGGPL-----GAVITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSH 274
            ||   ..||  |.|||||||     |    ..:|:.:..:|:.|:....|..   ..|:|.:..:
Mosquito   305 AGGEKGKDS--CRGDSGGPLMRYGDG----RSSTKSWYLIGLVSFGLEQCGTDGVPGVYTRMSEY 363

  Fly   275 AEFIL 279
            .:::|
Mosquito   364 MDWVL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/262 (31%)
Tryp_SPc 45..278 CDD:238113 79/261 (30%)
CLIPB1XP_307756.2 CLIP 32..85 CDD:288855
Tryp_SPc 114..367 CDD:214473 80/262 (31%)
Tryp_SPc 115..367 CDD:238113 79/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.