DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB4

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_307755.1 Gene:CLIPB4 / 1269159 VectorBaseID:AGAP003250 Length:360 Species:Anopheles gambiae


Alignment Length:272 Identity:73/272 - (26%)
Similarity:122/272 - (44%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM----FVCGGSLITDKLVLTAAHCFIA- 90
            |.||::...    |:|.|...|.:..||...:......    |.||||:|.::.:||||||..: 
Mosquito    98 PNCGVQLTD----RVIGGQPTKIDEFPWTALIEYEKPNGRFGFHCGGSVINERYILTAAHCITSI 158

  Fly    91 ----NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP------NTHANDIAILRL 145
                ..|.| ||||::.:.:   |....:|..:..:|...:..:..|      .:|.||||::|.
Mosquito   159 PRGWKVHRV-RLGEWDLSST---TDQEDDFYADAPIDLDIEKIIVHPGYNLQDKSHHNDIALIRF 219

  Fly   146 SKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD-----ALQTLDIRRQPPDV 205
            ::.:.|...|..||:...:..|:.........|.|||||:..|.|.     .|..:|::...|  
Mosquito   220 NREINYSSTISAICLPLSNSLRNRKHAGLSSYAAGWGKTETASASQKKLKVELTVVDVKDCSP-- 282

  Fly   206 CAKFIGQTIAGNQFCAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK---AS 266
            ..:..|.::...|.|||. ...:.|:|||||||    ..:.:..:..:|:.|:..:.|..   ..
Mosquito   283 AYQRNGISLDSTQMCAGGIRGKDTCSGDSGGPL----MRQMSGSWYLIGVVSFGPQKCGAPGVPG 343

  Fly   267 VFTDVLSHAEFI 278
            |:|:|..:.::|
Mosquito   344 VYTNVAEYVDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/257 (27%)
Tryp_SPc 45..278 CDD:238113 68/256 (27%)
CLIPB4XP_307755.1 CLIP 31..83 CDD:371857
Tryp_SPc 108..358 CDD:238113 69/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.