DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012736

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_307014.4 Gene:AgaP_AGAP012736 / 1268455 VectorBaseID:AGAP012736 Length:340 Species:Anopheles gambiae


Alignment Length:176 Identity:47/176 - (26%)
Similarity:72/176 - (40%) Gaps:47/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA 192
            |.||..:|...|||::.|:.|:.:.|.|:|:.:......|.:...:.  |.:|:|:|     :||
Mosquito    16 HPLYVSSTLRYDIAVVLLNSSITFTDRIQPVRLPARSDTRQFGGFVG--TLSGFGRT-----TDA 73

  Fly   193 LQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW------DSNL----------CNGDSGGPL---- 237
            .|::       ....:|....:..|..|...|      |.|:          |||||||||    
Mosquito    74 SQSI-------STVVRFTSNPVMTNANCITRWGSSNIQDQNVCLSGTGGRSSCNGDSGGPLTVES 131

  Fly   238 GAVITHKNTQRFVQVGIASYTN-RNCQKASVFTDVLSHAEFILRVW 282
            |..|         |:|:.|:.: |.|:..  ...|.|...|.|. |
Mosquito   132 GGPI---------QIGVVSFVSIRGCEAG--MPSVYSRVSFYLN-W 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 44/170 (26%)
Tryp_SPc 45..278 CDD:238113 44/170 (26%)
AgaP_AGAP012736XP_307014.4 Tryp_SPc <7..167 CDD:238113 47/176 (27%)
Tryp_SPc <7..166 CDD:214473 47/176 (27%)
Tryp_SPc <168..335 CDD:214473
Tryp_SPc <169..338 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.