DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:171 Identity:49/171 - (28%)
Similarity:79/171 - (46%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFL-------------------DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH----S 64
            :|||..|                   .|.|||:...    |:::|.:.:.:..||...:.    .
Mosquito   221 TGCSVVLCVIVDWTLSSTQKTSSLPESPHCGIQLGD----RVLSGQSTQIDEFPWTALIEFQKPD 281

  Fly    65 TTDMFVCGGSLITDKLVLTAAHCF--IANQHLV--ARLGEYERTRSEECTGYYCNFR------EE 119
            .:..|.||||||.|:.::|||||.  |.....|  .||||::...:.:|...:|:..      |:
Mosquito   282 GSFGFHCGGSLINDRYIVTAAHCIKSIPRDWKVQRVRLGEWDLATANDCQNEFCSDAPIDLDIEQ 346

  Fly   120 HMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160
            .:|..|:..|   ..::|||||::|.::.|.|...:||||:
Mosquito   347 IVVHTGYDTK---DKSNANDIALIRFTRPVNYSQTVRPICL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 41/131 (31%)
Tryp_SPc 45..278 CDD:238113 40/130 (31%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473
Tryp_SPc <1..149 CDD:238113
Tryp_SPc 261..>389 CDD:304450 40/127 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.