DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012843

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_306111.4 Gene:AgaP_AGAP012843 / 1267554 VectorBaseID:AGAP012843 Length:173 Species:Anopheles gambiae


Alignment Length:167 Identity:41/167 - (24%)
Similarity:84/167 - (50%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA 192
            |:.|:.:...||||::|:|::|.:..:::|.|:.:::.:...|....:| :.|||:.|..:.||:
Mosquito     8 HQNYNSHARLNDIALIRVSEAVQFTKDVKPACLPFNYLFDESLASPRVL-SLGWGEYQQGTMSDS 71

  Fly   193 LQTLDIRRQPPDVCAKFIGQ------TIAGNQFC-----AGNWDSNLCNGDSGGPLGAVITHKNT 246
            .:.:.:.....|.|.:.:.:      ::..:..|     ||   .::|.||||.|   ::..:|.
Mosquito    72 KRIVQLEIIKEDECGEQLKKWQRFNISMISSVMCTVGVLAG---QDVCEGDSGAP---IVQIRND 130

  Fly   247 QRFVQVGIASYTNRNCQK----ASVFTDVLSHAEFIL 279
            :.|| :|:.|: ...|..    |.:.|.|..:..:||
Mosquito   131 RYFV-IGVVSF-GPKCGMGTGIAGMSTRVSEYKNWIL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 39/164 (24%)
Tryp_SPc 45..278 CDD:238113 39/164 (24%)
AgaP_AGAP012843XP_306111.4 Tryp_SPc <1..164 CDD:214473 39/164 (24%)
Tryp_SPc <1..164 CDD:238113 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.