DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Ctrl

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:289 Identity:86/289 - (29%)
Similarity:126/289 - (43%) Gaps:51/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHS--GCS-QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73
            :.:.|...||.|  ||. ..:.||....      .||:||..|...|.||.|.|...|....|||
  Rat     4 LSLTLSLVLLGSSWGCGVPAITPALSYN------QRIVNGENAVPGSWPWQVSLQDNTGFHFCGG 62

  Fly    74 SLITDKLVLTAAHCFIA-NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            |||....|:|||||.:. .:|.|. ||||:|:.:.|..       :...:.....|..::|||..
  Rat    63 SLIAPNWVVTAAHCKVTPGRHFVI-LGEYDRSSNAEPI-------QVLSISKAITHPSWNPNTMN 119

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTA------TGWGK-------TQMESD 189
            ||:.:|:|:....|...:.|:|:...:         :.|.|      ||||:       |.....
  Rat   120 NDLTLLKLASPARYTAQVSPVCLASSN---------EALPAGLTCVTTGWGRISGVGNVTPARLQ 175

  Fly   190 SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            ...|..:.:.:     |.::.|..|..:..|||...::.|.|||||||  |....||  :|.:||
  Rat   176 QVVLPLVTVNQ-----CRQYWGSRITDSMICAGGAGASSCQGDSGGPL--VCQKGNT--WVLIGI 231

  Fly   255 ASYTNRNC--QKASVFTDVLSHAEFILRV 281
            .|:...||  |..:::|.|.....:|.:|
  Rat   232 VSWGTENCNVQAPAMYTRVSKFNTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/249 (31%)
Tryp_SPc 45..278 CDD:238113 75/248 (30%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 76/249 (31%)
Tryp_SPc 34..260 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.